Word Data

Word-Trivia Myths, Fact-Checked

By Lucian — builder & engineer, LK Forge

Some of the most-shared word facts are repeated far more often than they're checked. We ran the popular ones through every word in the 172,835-word ENABLE open list — the same list behind our Word Unscrambler — to see which hold up. Two of the favourites don't.

172,835
ENABLE words checked
6
vowels-in-order words (not 2)
6
words tie "typewriter"
22
words with Q but no U

Myth 1: “Only two words have all five vowels in order”

The claim that abstemious and facetious are the only words whose vowels read a, e, i, o, u in sequence is everywhere. Take the definition literally — the vowels of the word, left to right, are exactly a-e-i-o-u, each once — and ENABLE holds six, not two:

facetiousabstemiousarseniousabstentiousfacetiouslyabstemiously

The famous pair are joined by arsenious and abstentious, plus the adverb forms facetiously and abstemiously. Loosen the rule to allow repeated or extra vowels between them and the a-e-i-o-u run appears in 28 ENABLE words — but the strict, one-of-each version is the one the myth is really about, and it's six.

Myth 2: “Typewriter is the longest one-keyboard-row word”

Typewriter really can be typed on the top row alone — but it isn't the longest. Five other ten-letter words tie it, and only the top row gets anywhere near that length. Here's the longest word each row can spell in ENABLE:

Top row Q W E R T Y U I O P 10 · typewriter Home row A S D F G H J K L 9 · haggadahs Bottom row Z X C V B N M 2 · mm lkforge.com

Six words share the ten-letter top-row record — typewriter is just the memorable one:

typewriterproprietorperpetuityrepertoirepeppertreeprerequire

You'll sometimes see eleven-letter claims for the top row; none of those words are in the ENABLE list, so within a standard word list ten is the ceiling. The home row tops out at nine (haggadahs), and the bottom row — with no vowels among z, x, c, v, b, n, m — can't manage more than two letters.

Words with no vowel at all

Drop a, e, i, o and u entirely and ENABLE still has 121 words — the longest at seven letters, carried by y standing in for a vowel:

rhythmsglycylstsktskscrwthcwmnthphphtpfftpsstbrrr

Bar y as well and just 20 survive — the interjections and oddities like tsktsks, crwth (a Welsh string instrument) and cwm (a mountain hollow).

Q doesn't always need U

“Q is always followed by U” is a good rule of thumb and a bad absolute. ENABLE holds 22 words with a Q and no U — mostly loanwords and currency names:

qiqatqophqaidqanatfaqirtranqqwertysheqelqindarkasheqalim

One word, all five vowels

Words that pack a, e, i, o and u in once each — in any order — are less rare than they feel: 717 of them. The shortest run seven letters:

eulogiasequoiamiaouedaequorinaerobium

The six-letter eunoia often cited as the shortest isn't in the ENABLE list, so seven is the floor here. Every count on this page is scoped to that one list — change the dictionary and the numbers move, which is exactly why it's worth naming the list. These come from the same word data behind our Word Unscrambler, Word Generator, and Word Search Solver.

Reproduce this study Run it yourself →
  • Word list: the ENABLE open list (172,835 words) — the exact data the Word Unscrambler ships, fetched at runtime.
  • Vowels in order: words whose vowels read exactly a-e-i-o-u, each once. Expected: 6.
  • Keyboard rows: longest word spellable from one QWERTY row. Expected: top 10, home 9, bottom 2.
  • Extras: no-vowel words (121), Q-without-U (22), all five vowels once (717).

Every number on this page is printed by one script against the shipped ENABLE list. Counts hold for that list specifically; a different dictionary gives different totals.